PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_02032A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 673aa    MW: 74906.9 Da    PI: 7.3628
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_02032AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.61.6e-091557347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               +WT +E+e++ +a +q G++ +++I ++++  +   q++++++ +
  Oropetium_20150105_02032A 15 AWTRQEEEKFFNALRQVGKN-FEKITHRVQ-SKNKDQVRHYYYRL 57
                               6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129313.561162IPR017884SANT domain
SMARTSM007171.6E-71260IPR001005SANT/Myb domain
SuperFamilySSF466893.07E-101261IPR009057Homeodomain-like
CDDcd001674.40E-71558No hitNo description
PfamPF002492.5E-71557IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-61560IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    Send to blast
MSNTKSAPGT RQWAAWTRQE EEKFFNALRQ VGKNFEKITH RVQSKNKDQV RHYYYRLVRR  60
MKKLLGPEFS LDAKDSKDTI AAMLRWWSLL EKFSCSASKL HLKPRRFKSF VEALGNQLLK  120
DRNKSRRKCS RVDMCLFSES SGLSRAPGNE PLPLKFLSED AQNASKLLSP KGTFLKRSTE  180
TNSNKSGATK GDLSATRTVK QKRRAGGVIP SAAYKKWEKA AMAGVSLVAD AAEELERSTV  240
DPSLFCNVDA RTFTSSSSNI STVDGISINP VREADPQAPT KLKLQLFPIN EATRKALEKD  300
EHNPHLELTL SSRKKISSVL EHLNRKWGNS NIAYGELMLF PYCAHQEDLA TYQRWTTRDT  360
VAVADVFVSL NSPIFRLRYG WFSLVELEAG VSEISLTQFE NCMIPEDIQI KTSSGENFRM  420
QEDSEQYPCH SKDQSTILPA TPSQKSKNDE VPQQPVDAPS SQFAKQKQVE VPATYAFEAL  480
LPSFAFFQKD DQGINSAAIS EGEWADTLTD ISVGYLLTEA SKGAHSDCTG TSIVKSALFL  540
ENPCSYDSFD AAVALHASRY QSTEQAAHTS HATIWGADET CDGFSFHLSA VRKKKGSNSG  600
ASSSRDGDNE IHPLNSEGFQ GFLQDLTGVE AADNLYTDDA KDTEELHAKS PSQSGDRNEL  660
KDQCLADIYW RI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985049.10.0PREDICTED: TSL-kinase interacting protein 1
TrEMBLA0A0A9QC340.0A0A0A9QC34_ARUDO; Uncharacterized protein
STRINGSi034363m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54783643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.21e-149TSL-kinase interacting protein 1